PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr022051.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 1664aa    MW: 181520 Da    PI: 5.8182
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr022051.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.86e-09792834246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      ++W +eE el+++  + +G++ +++Ia+ +  ++t  +c+++++k
      Pbr022051.1 792 NPWMPEEKELFIQKLTIYGKD-FRKIASFLD-HKTTADCVEFYYK 834
                      68*****************99.*********.***********98 PP

2Myb_DNA-binding28.34.1e-0910111051345
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding    3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45  
                        WT eE   +++av  +G++ ++ I+r++   R+  qck ++ 
      Pbr022051.1 1011 DWTDEEKSSFIQAVSSYGKD-FAMISRCIR-SRSQHQCKVFFS 1051
                       6*****************99.*********.********8776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.97E-14777838IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-5787837IPR009057Homeodomain-like
PROSITE profilePS5129315.529789840IPR017884SANT domain
SMARTSM007171.5E-8790838IPR001005SANT/Myb domain
PfamPF002497.0E-6792834IPR001005SANT/Myb domain
PROSITE profilePS5129311.02610071058IPR017884SANT domain
SMARTSM007171.4E-610081056IPR001005SANT/Myb domain
SuperFamilySSF466897.02E-1010091058IPR009057Homeodomain-like
PfamPF002491.5E-610111051IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-510111052IPR009057Homeodomain-like
CDDcd001671.38E-510121050No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1664 aa     Download sequence    Send to blast
MPPEPLPWDR KDFFKERKHE RSESLGSVAR WRDSPHHAPR DFNRWPSGDF RRPPGHGKQG  60
AWHVFSDDSG HGYGSSRSGD KMLEDESFRP SFSRGDGRYG RNSRDNRGPP YSQRETKGHS  120
WDARSGSPNM PGRPNHNEQK SQDDMLTYSS HQPSDFGSTW DRIQLKDQLD RMGGSTGLGA  180
GQKCERENSL GSIDWKPLKW TRSGSLSSRV SGFSHLSSSK SMGPVDSNEA MVNSQPKNAT  240
PVQSPSGEAT TGVTSAAPSE ETTSRKKPRL GWGEGLAKYE KKKVEVPDAS MNNDGAVCSV  300
GNTEPAHSLS SSLPDKSPRV TIFLDCASPA TPSSVVCSSS PGVEEKSFCK AVNIDNDIRN  360
VCGSPGHMSQ SHHEGFSFQL EKLDSNSIVN LDSSLLELLQ SDDPSSVDSS SRRPTALNKL  420
LIWKGEISKV LEVTESEIDS LENELKALNS DSGGSCPHPA TSSSLPVEDK DKSCKEHVTN  480
LITLPIALQI HSSGDTDVQK MCVDNRDQVE FCGIVNDEDI DSPGTATSKF VESFPLVSSS  540
DMMNQTGCSE DWDPIQTTIG EETCSVPSRC TEKTDPSTCG NSSMLLDKEI VAPACGVVDK  600
LSDSIFSANK EFASRASDIF SKLLPKEQYE VDPSGVSVPS SWKNDPLNKE KFAKRKQHLR  660
FMERVVTLKF KAFQHLWKED MHLLSMRKCR SKSHKNIELS LRATNNGHQK HRSSIRSRFS  720
TPAGSLTLFP ATETINFTNK LLSDSQVKLY RNSLKMPALI LDKKEKMATR FVSSNGLVED  780
PCAVENERAL MNPWMPEEKE LFIQKLTIYG KDFRKIASFL DHKTTADCVE FYYKNHKSDC  840
FKKAKKKPDM AKQEKSSANT YLISNGKKWN REMHAASLDI LGAASAIAAH AESSTRNRQT  900
YSRRLILGGY KNTNTSYGDD TMVERPCSFD TIGNERETAA ADVLAGICGS ISSEAVSSCI  960
TSSIDPVESY REWKCQKVDS VVRRPLTPDV MHNVDDETCS DESCGEMDPS DWTDEEKSSF  1020
IQAVSSYGKD FAMISRCIRS RSQHQCKVFF SKARKCLGLD LVHPRPGNGT SVGDDANGGG  1080
SDAEDACDLE TGSGISSDKS GCNMNEDLPS SVTNMNDDEA EPAESMKLQT SPLRPEENNA  1140
MAEVDHGDGK PLKFLAFGDD TDIMDSGAMG GNVTENGILV AESLTVGEGI NSDTPNPECM  1200
VGEKLVGQNS FDRFGKELEG GDERTNRGKS GCHIPVSVHD LCGNASDQAT DGSCSGLNPE  1260
YLHEVSVELN SVQKPSVIPL PLENPLATAD TAGQDSAAIE CEKSLDQDRL SSTPDLQEGR  1320
DHQCSKSVGE DDSRKHLSGF PVYTNVEPSQ VIRGYPLQIA TKKETNGDIS CGNLSEAKPD  1380
RNINGHYMTQ NGFLQFRNCK PSCSEVDFPP VPLKILSNPS KSTSSIHENE EGAHNHQLSN  1440
KASNLKFTGH HSADGSSPLL KFDCGGYLGL ENVPRRSYGG FWEGNKVRTG FSSFPDSAIL  1500
LAKYPAAFSN FPTSSSQMEQ QPLQAVVKTS DGSLNGVSIF PGMEINGSNG VVDYPVFSRG  1560
RDGGAKVQPF TVDVKQQRQD MFDIPRRNGL DAITSLQQQG RAIVGMNVMG RGGILVGGPC  1620
TGVSDPVAAI RMHYAKTEQY GGQAGSIVGE EESWRGGKGD IGR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C9e-15756842994NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D9e-15756842994NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009378096.10.0PREDICTED: uncharacterized protein LOC103966637 isoform X1
TrEMBLM5XR660.0M5XR66_PRUPE; Uncharacterized protein
STRINGVIT_13s0019g04010.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF49863352
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.11e-153MYB family protein